PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Aradu.35LC8
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Dalbergieae; Arachis
Family MYB_related
Protein Properties Length: 252aa    MW: 29226.7 Da    PI: 8.6248
Description MYB_related family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Aradu.35LC8genomeNCGR_PGCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding42.51.5e-13100144347
                      SS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
  Myb_DNA-binding   3 rWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                      +WT+eE+ +++ +  ++G+g+W+ I+r +  ++t+ q+ s+ qky
      Aradu.35LC8 100 PWTQEEHRRFLMGLLKYGKGDWRNISRNFVVTKTPTQVASHAQKY 144
                      8*******************************************9 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129419.10393149IPR017930Myb domain
SuperFamilySSF466893.89E-1694149IPR009057Homeodomain-like
TIGRFAMsTIGR015576.2E-1796148IPR006447Myb domain, plants
Gene3DG3DSA:1.10.10.601.0E-1097143IPR009057Homeodomain-like
SMARTSM007179.5E-1197147IPR001005SANT/Myb domain
PfamPF002497.3E-11100144IPR001005SANT/Myb domain
CDDcd001675.00E-8100144No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 252 aa     Download sequence    Send to blast
MIFPRFSSIQ KGLMELESVC PGWNWNWNLL EQERQSSSRE WSKEDNKKFE SAKAGRVPVP  60
GYIASSFTFE LLHHHNHDGS RRRPNTPRPS SDQERKKGVP WTQEEHRRFL MGLLKYGKGD  120
WRNISRNFVV TKTPTQVASH AQKYYIRQKV SSGGKDKRRP SIHDITTLNL AEATATLDDN  180
NNNINKPLSF NESKVQLDWF NHCNDDGSVM VFDPNCDHLQ EQDLFDCAFH EAYAKLKIPH  240
FNKEADFGIH AL
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankKF2086830.0KF208683.1 Arachis hypogaea putative MYB-related protein 29 (MYB29) gene, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_016166940.11e-168PREDICTED: transcription factor DIVARICATA-like
RefseqXP_016166941.11e-168PREDICTED: transcription factor DIVARICATA-like
SwissprotQ8S9H72e-50DIV_ANTMA; Transcription factor DIVARICATA
TrEMBLV5T8J41e-172V5T8J4_ARAHY; Putative MYB-related protein 29
STRINGGLYMA14G06750.13e-94(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF46634162
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G11280.24e-44MYB family protein